Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Fibroblast collagenase (MMP-1) [55529] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [55530] (13 PDB entries) Uniprot P03956 32-466 |
Domain d1su3a3: 1su3 A:107-270 [112119] Other proteins in same PDB: d1su3a1, d1su3a2, d1su3b1, d1su3b2 complexed with ca, cl, epe, na, so4, zn |
PDB Entry: 1su3 (more details), 2.2 Å
SCOPe Domain Sequences for d1su3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1su3a3 d.92.1.11 (A:107-270) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} prweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrg dhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgl shstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpi
Timeline for d1su3a3: