SCOP 1.73: Domain d1su3a3: 1su3 A:107-270

Lineage for d1su3a3 (1su3 A:107-270)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55530] (12 PDB entries)

8. Domain d1su3a3: 1su3 A:107-270 [112119]
   Other proteins in same PDB: d1su3a1, d1su3a2, d1su3b1, d1su3b2

Details for d1su3a3

PDB Entry: 1su3, 2.2 Å

PDB Description: X-ray structure of human proMMP-1: New insights into collagenase action

PDB Compounds: (A:) interstitial collagenase

SCOP Domain Sequences for d1su3a3:

Sequence; same for both SEQRES and ATOM records:

>d1su3a3 d.92.1.11 (A:107-270) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
prweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrg
dhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgl
shstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpi

Timeline for d1su3a3:

• d1su3a3 first appeared in SCOP 1.71
  
• d1su3a3 appears in SCOP 1.75
  
• d1su3a3 appears in the current release, SCOPe 2.08