Lineage for d1su3a3 (1su3 A:107-270)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964341Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 2964342Species Human (Homo sapiens) [TaxId:9606] [55530] (13 PDB entries)
    Uniprot P03956 32-466
  8. 2964348Domain d1su3a3: 1su3 A:107-270 [112119]
    Other proteins in same PDB: d1su3a1, d1su3a2, d1su3b1, d1su3b2
    complexed with ca, cl, epe, na, so4, zn

Details for d1su3a3

PDB Entry: 1su3 (more details), 2.2 Å

PDB Description: X-ray structure of human proMMP-1: New insights into collagenase action
PDB Compounds: (A:) interstitial collagenase

SCOPe Domain Sequences for d1su3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1su3a3 d.92.1.11 (A:107-270) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
prweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrg
dhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgl
shstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpi

SCOPe Domain Coordinates for d1su3a3:

Click to download the PDB-style file with coordinates for d1su3a3.
(The format of our PDB-style files is described here.)

Timeline for d1su3a3: