Lineage for d1su3a2 (1su3 A:271-465)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565285Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 565286Superfamily b.66.1: Hemopexin-like domain [50923] (1 family) (S)
  5. 565287Family b.66.1.1: Hemopexin-like domain [50924] (5 proteins)
  6. 565288Protein Collagenase (MMP1), C-terminal domain [50929] (2 species)
  7. 565289Species Human (Homo sapiens) [TaxId:9606] [117271] (1 PDB entry)
  8. 565290Domain d1su3a2: 1su3 A:271-465 [112118]
    Other proteins in same PDB: d1su3a1, d1su3a3, d1su3b1, d1su3b3

Details for d1su3a2

PDB Entry: 1su3 (more details), 2.2 Å

PDB Description: X-ray structure of human proMMP-1: New insights into collagenase action

SCOP Domain Sequences for d1su3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens)}
gpqtpkacdskltfdaittirgevmffkdrfymrtnpfypevelnfisvfwpqlpnglea
ayefadrdevrffkgnkywavqgqnvlhgypkdiyssfgfprtvkhidaalseentgkty
ffvankywrydeykrsmdpgypkmiahdfpgighkvdavfmkdgffyffhgtrqykfdpk
tkriltlqkanswfn

SCOP Domain Coordinates for d1su3a2:

Click to download the PDB-style file with coordinates for d1su3a2.
(The format of our PDB-style files is described here.)

Timeline for d1su3a2: