Lineage for d1su3a2 (1su3 A:271-465)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807265Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 2807266Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 2807267Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)
  6. 2807268Protein Collagenase (MMP1), C-terminal domain [50929] (2 species)
  7. 2807269Species Human (Homo sapiens) [TaxId:9606] [117271] (1 PDB entry)
    Uniprot P03956 32-466
  8. 2807270Domain d1su3a2: 1su3 A:271-465 [112118]
    Other proteins in same PDB: d1su3a1, d1su3a3, d1su3b1, d1su3b3
    complexed with ca, cl, epe, na, so4, zn

Details for d1su3a2

PDB Entry: 1su3 (more details), 2.2 Å

PDB Description: X-ray structure of human proMMP-1: New insights into collagenase action
PDB Compounds: (A:) interstitial collagenase

SCOPe Domain Sequences for d1su3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gpqtpkacdskltfdaittirgevmffkdrfymrtnpfypevelnfisvfwpqlpnglea
ayefadrdevrffkgnkywavqgqnvlhgypkdiyssfgfprtvkhidaalseentgkty
ffvankywrydeykrsmdpgypkmiahdfpgighkvdavfmkdgffyffhgtrqykfdpk
tkriltlqkanswfn

SCOPe Domain Coordinates for d1su3a2:

Click to download the PDB-style file with coordinates for d1su3a2.
(The format of our PDB-style files is described here.)

Timeline for d1su3a2: