Lineage for d1su3a1 (1su3 A:32-98)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637353Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 637354Superfamily a.20.1: PGBD-like [47090] (2 families) (S)
  5. 637363Family a.20.1.2: MMP N-terminal domain [63427] (4 proteins)
  6. 637364Protein Fibroblast collagenase (MMP-1) [116864] (1 species)
  7. 637365Species Human (Homo sapiens) [TaxId:9606] [116865] (1 PDB entry)
  8. 637366Domain d1su3a1: 1su3 A:32-98 [112117]
    Other proteins in same PDB: d1su3a2, d1su3a3, d1su3b2, d1su3b3

Details for d1su3a1

PDB Entry: 1su3 (more details), 2.2 Å

PDB Description: X-ray structure of human proMMP-1: New insights into collagenase action
PDB Compounds: (A:) interstitial collagenase

SCOP Domain Sequences for d1su3a1:

Sequence, based on SEQRES records: (download)

>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
dlvqkylekyynlkndgrqvekrrnsgpvveklkqmqeffglkvtgkpdaetlkvmkqpr
cgvpdva

Sequence, based on observed residues (ATOM records): (download)

>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
dlvqkylekyynlkgpvveklkqmqeffglkvtgkpdaetlkvmkqprcgvpdva

SCOP Domain Coordinates for d1su3a1:

Click to download the PDB-style file with coordinates for d1su3a1.
(The format of our PDB-style files is described here.)

Timeline for d1su3a1: