Lineage for d1ssla_ (1ssl A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703340Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 1703369Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 1703370Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam PF01437
  6. 1703371Protein Hepatocyte growth factor receptor [111407] (1 species)
  7. 1703372Species Human (Homo sapiens) [TaxId:9606] [111408] (2 PDB entries)
    Uniprot P08581 40-564
  8. 1703374Domain d1ssla_: 1ssl A: [112113]

Details for d1ssla_

PDB Entry: 1ssl (more details)

PDB Description: solution structure of the psi domain from the met receptor
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d1ssla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssla_ g.16.2.1 (A:) Hepatocyte growth factor receptor {Human (Homo sapiens) [TaxId: 9606]}
gsamgcrhfqscsqclsappfvqcgwchdkcvrseeclsgtwtqqicl

SCOPe Domain Coordinates for d1ssla_:

Click to download the PDB-style file with coordinates for d1ssla_.
(The format of our PDB-style files is described here.)

Timeline for d1ssla_: