Lineage for d1srza1 (1srz A:96-159)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034016Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 3034252Protein GABA-B receptor 1 [118257] (1 species)
  7. 3034253Species Norway rat (Rattus norvegicus) [TaxId:10116] [118258] (2 PDB entries)
    Uniprot Q9Z0U4 96-159
  8. 3034254Domain d1srza1: 1srz A:96-159 [112110]
    Other proteins in same PDB: d1srza2

Details for d1srza1

PDB Entry: 1srz (more details)

PDB Description: solution structure of the second complement control protein (ccp) module of the gaba(b)r1a receptor, pro-119 trans conformer
PDB Compounds: (A:) Gamma-aminobutyric acid type B receptor, subunit 1

SCOPe Domain Sequences for d1srza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srza1 g.18.1.1 (A:96-159) GABA-B receptor 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vricsksyltlengkvfltggdlpaldgarvefrcdpdfhlvgssrsvcsqgqwstpkph
cqvn

SCOPe Domain Coordinates for d1srza1:

Click to download the PDB-style file with coordinates for d1srza1.
(The format of our PDB-style files is described here.)

Timeline for d1srza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1srza2