SCOPe 2.05: Domain d1sr2a_: 1sr2 A:

Lineage for d1sr2a_ (1sr2 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.4: Sensor-like histidine kinase YojN, C-terminal domain [116868] (1 protein)

6. Protein Sensor-like histidine kinase YojN, C-terminal domain [116869] (1 species)

7. Species Escherichia coli [TaxId:562] [116870] (1 PDB entry)
   Uniprot P39838 775-890

8. Domain d1sr2a_: 1sr2 A: [112109]

Details for d1sr2a_

PDB Entry: 1sr2

PDB Description: solution structure of the escherichia coli yojn histidine- phosphotransferase (hpt) domain

PDB Compounds: (A:) Putative sensor-like histidine kinase yojN

SCOPe Domain Sequences for d1sr2a_:

Sequence; same for both SEQRES and ATOM records:

>d1sr2a_ a.24.10.4 (A:) Sensor-like histidine kinase YojN, C-terminal domain {Escherichia coli [TaxId: 562]}
mqeavlqlievqlaqeevtesplggdenaqlhasgyyalfvdtvpddvkrlyteaatsdf
aalaqtahrlkgvfamlnlvpgkqlcetlehlirekdvpgiekyisdidsyvksll

Timeline for d1sr2a_:

• d1sr2a_ first appeared in SCOP 1.71
  
• d1sr2a_ appears in SCOPe 2.04
  
• d1sr2a_ appears in SCOPe 2.06
  
• d1sr2a_ appears in the current release, SCOPe 2.08