Lineage for d1sr2a_ (1sr2 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535478Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 535680Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (5 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 535715Family a.24.10.4: Sensor-like histidine kinase YojN, C-terminal domain [116868] (1 protein)
  6. 535716Protein Sensor-like histidine kinase YojN, C-terminal domain [116869] (1 species)
  7. 535717Species Escherichia coli [TaxId:562] [116870] (1 PDB entry)
  8. 535718Domain d1sr2a_: 1sr2 A: [112109]

Details for d1sr2a_

PDB Entry: 1sr2 (more details)

PDB Description: Solution structure of the Escherichia coli YojN Histidine-Phosphotransferase (HPt) domain

SCOP Domain Sequences for d1sr2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sr2a_ a.24.10.4 (A:) Sensor-like histidine kinase YojN, C-terminal domain {Escherichia coli}
mqeavlqlievqlaqeevtesplggdenaqlhasgyyalfvdtvpddvkrlyteaatsdf
aalaqtahrlkgvfamlnlvpgkqlcetlehlirekdvpgiekyisdidsyvksll

SCOP Domain Coordinates for d1sr2a_:

Click to download the PDB-style file with coordinates for d1sr2a_.
(The format of our PDB-style files is described here.)

Timeline for d1sr2a_: