![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (5 families) ![]() contains additional, fifth helix at the N-terminus |
![]() | Family a.24.10.4: Sensor-like histidine kinase YojN, C-terminal domain [116868] (1 protein) |
![]() | Protein Sensor-like histidine kinase YojN, C-terminal domain [116869] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [116870] (1 PDB entry) |
![]() | Domain d1sr2a_: 1sr2 A: [112109] |
PDB Entry: 1sr2 (more details)
SCOP Domain Sequences for d1sr2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sr2a_ a.24.10.4 (A:) Sensor-like histidine kinase YojN, C-terminal domain {Escherichia coli} mqeavlqlievqlaqeevtesplggdenaqlhasgyyalfvdtvpddvkrlyteaatsdf aalaqtahrlkgvfamlnlvpgkqlcetlehlirekdvpgiekyisdidsyvksll
Timeline for d1sr2a_: