Lineage for d1sqra_ (1sqr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793276Family b.43.3.3: Ribosomal protein L35ae [117220] (1 protein)
    Pfam PF01247
  6. 2793277Protein Ribosomal protein L35ae [117221] (1 species)
  7. 2793278Species Pyrococcus furiosus [TaxId:2261] [117222] (1 PDB entry)
    Uniprot Q8TZV6
  8. 2793279Domain d1sqra_: 1sqr A: [112108]
    Structural genomics target

Details for d1sqra_

PDB Entry: 1sqr (more details)

PDB Description: solution structure of the 50s ribosomal protein l35ae from pyrococcus furiosus. northeast structural genomics consortium target pfr48.
PDB Compounds: (A:) 50S ribosomal protein L35Ae

SCOPe Domain Sequences for d1sqra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqra_ b.43.3.3 (A:) Ribosomal protein L35ae {Pyrococcus furiosus [TaxId: 2261]}
mrikgvvlsyrrskenqhnnvmiikpldvnsreeaskligrlvlwkspsgkilkgkivrv
hgtkgavrarfekglpgqalgdyveiv

SCOPe Domain Coordinates for d1sqra_:

Click to download the PDB-style file with coordinates for d1sqra_.
(The format of our PDB-style files is described here.)

Timeline for d1sqra_: