![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
![]() | Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) ![]() |
![]() | Family d.82.2.1: Frataxin-like [55388] (3 proteins) iron homeostasis proteins automatically mapped to Pfam PF01491 |
![]() | Protein CyaY [55391] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55392] (4 PDB entries) Uniprot P27838 |
![]() | Domain d1soya_: 1soy A: [112107] |
PDB Entry: 1soy (more details)
SCOPe Domain Sequences for d1soya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1soya_ d.82.2.1 (A:) CyaY {Escherichia coli [TaxId: 562]} mndsefhrladqlwltieerlddwdgdsdidceinggvltitfengskiiinrqeplhqv wlatkqggyhfdlkgdewicdrsgetfwdlleqaatqqagetvsfr
Timeline for d1soya_: