Lineage for d1soya_ (1soy A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962266Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2962311Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) (S)
  5. 2962312Family d.82.2.1: Frataxin-like [55388] (3 proteins)
    iron homeostasis proteins
    automatically mapped to Pfam PF01491
  6. 2962323Protein CyaY [55391] (1 species)
  7. 2962324Species Escherichia coli [TaxId:562] [55392] (4 PDB entries)
    Uniprot P27838
  8. 2962328Domain d1soya_: 1soy A: [112107]

Details for d1soya_

PDB Entry: 1soy (more details)

PDB Description: solution structure of the bacterial frataxin orthologue, cyay
PDB Compounds: (A:) cyay protein

SCOPe Domain Sequences for d1soya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soya_ d.82.2.1 (A:) CyaY {Escherichia coli [TaxId: 562]}
mndsefhrladqlwltieerlddwdgdsdidceinggvltitfengskiiinrqeplhqv
wlatkqggyhfdlkgdewicdrsgetfwdlleqaatqqagetvsfr

SCOPe Domain Coordinates for d1soya_:

Click to download the PDB-style file with coordinates for d1soya_.
(The format of our PDB-style files is described here.)

Timeline for d1soya_: