Lineage for d1snta_ (1snt A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065211Protein Sialidase 2 (Neu2) [117274] (1 species)
  7. 2065212Species Human (Homo sapiens) [TaxId:9606] [117275] (14 PDB entries)
    Uniprot Q9Y3R4
  8. 2065217Domain d1snta_: 1snt A: [112105]

Details for d1snta_

PDB Entry: 1snt (more details), 1.75 Å

PDB Description: Structure of the human cytosolic sialidase Neu2
PDB Compounds: (A:) Sialidase 2

SCOPe Domain Sequences for d1snta_:

Sequence, based on SEQRES records: (download)

>d1snta_ b.68.1.1 (A:) Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9606]}
slpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdydap
thqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtranvt
rlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpayayr
klhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshlra
rvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythpthsw
qradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeei
vflmftlkqafpaey

Sequence, based on observed residues (ATOM records): (download)

>d1snta_ b.68.1.1 (A:) Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9606]}
slpvlqkesvfqsgahayripallylpgqqsllafaeqraelivlrrgdydapthqvqwq
aqevvaqarldghrsmnpcplydaqtgtlflffiaipanvtrlcqvtstdhgrtwssprd
ltdaaigpayrewstfavgpghclqlndrarslvvpayayrklhpiqrpipsafcflshd
hgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshlrarvqaqstndgldfqesqlv
kklvepppqgcqgsvisfpsprspaqwllythpthswqradlgaylnprppapeawsepv
llakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmftlkqafpaey

SCOPe Domain Coordinates for d1snta_:

Click to download the PDB-style file with coordinates for d1snta_.
(The format of our PDB-style files is described here.)

Timeline for d1snta_: