Lineage for d1sm9d_ (1sm9 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829505Protein Xylose reductase [75058] (1 species)
  7. 2829506Species Fungus (Candida tenuis) [TaxId:45596] [75059] (8 PDB entries)
    Uniprot O74237
  8. 2829532Domain d1sm9d_: 1sm9 D: [112103]
    complexed with nad; mutant

Details for d1sm9d_

PDB Entry: 1sm9 (more details), 2.2 Å

PDB Description: crystal structure of an engineered k274rn276d double mutant of xylose reductase from candida tenuis optimized to utilize nad
PDB Compounds: (D:) xylose reductase

SCOPe Domain Sequences for d1sm9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm9d_ c.1.7.1 (D:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiaviprsdlperlvqnrsfntfdltkedfeeiakl
diglrfndpwdwdnipifv

SCOPe Domain Coordinates for d1sm9d_:

Click to download the PDB-style file with coordinates for d1sm9d_.
(The format of our PDB-style files is described here.)

Timeline for d1sm9d_: