![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) ![]() |
![]() | Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
![]() | Protein Xylose reductase [75058] (1 species) |
![]() | Species Fungus (Candida tenuis) [TaxId:45596] [75059] (8 PDB entries) Uniprot O74237 |
![]() | Domain d1sm9c_: 1sm9 C: [112102] complexed with nad; mutant |
PDB Entry: 1sm9 (more details), 2.2 Å
SCOPe Domain Sequences for d1sm9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sm9c_ c.1.7.1 (C:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]} sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd tikaiaakynktpaevllrwaaqrgiaviprsdlperlvqnrsfntfdltkedfeeiakl diglrfndpwdwdnipifv
Timeline for d1sm9c_: