Lineage for d1sm9b_ (1sm9 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2092401Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2092402Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2092729Protein Xylose reductase [75058] (1 species)
  7. 2092730Species Fungus (Candida tenuis) [TaxId:45596] [75059] (8 PDB entries)
    Uniprot O74237
  8. 2092746Domain d1sm9b_: 1sm9 B: [112101]
    complexed with nad; mutant

Details for d1sm9b_

PDB Entry: 1sm9 (more details), 2.2 Å

PDB Description: crystal structure of an engineered k274rn276d double mutant of xylose reductase from candida tenuis optimized to utilize nad
PDB Compounds: (B:) xylose reductase

SCOPe Domain Sequences for d1sm9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm9b_ c.1.7.1 (B:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiaviprsdlperlvqnrsfntfdltkedfeeiakl
diglrfndpwdwdnipifv

SCOPe Domain Coordinates for d1sm9b_:

Click to download the PDB-style file with coordinates for d1sm9b_.
(The format of our PDB-style files is described here.)

Timeline for d1sm9b_: