Lineage for d1sl8a_ (1sl8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710588Protein Calcium-regulated photoprotein [47512] (4 species)
    structurally most similar to sarcoplasmic calcium-binding protein
  7. 2710603Species Jellyfish (Aequorea victoria), aequorin 1 [TaxId:6100] [116901] (1 PDB entry)
    Uniprot P07164 16-196
  8. 2710604Domain d1sl8a_: 1sl8 A: [112099]
    Structural genomics target
    complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d1sl8a_

PDB Entry: 1sl8 (more details), 1.7 Å

PDB Description: Calcium-loaded apo-aequorin from Aequorea victoria
PDB Compounds: (A:) Aequorin 1

SCOPe Domain Sequences for d1sl8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sl8a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Jellyfish (Aequorea victoria), aequorin 1 [TaxId: 6100]}
npkwigrhkhmfnfldvnhngrisldemvykasdivinnlgatpeqakrhkdaveaffgg
agmkygvetewpeyiegwkrlaseelkrysknqitlirlwgdalfdiidkdqngaislde
wkaytksagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpaceklyggav
p

SCOPe Domain Coordinates for d1sl8a_:

Click to download the PDB-style file with coordinates for d1sl8a_.
(The format of our PDB-style files is described here.)

Timeline for d1sl8a_: