![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calcium-regulated photoprotein [47512] (4 species) structurally most similar to sarcoplasmic calcium-binding protein |
![]() | Species Jellyfish (Aequorea victoria), aequorin 1 [TaxId:6100] [116901] (1 PDB entry) Uniprot P07164 16-196 |
![]() | Domain d1sl8a_: 1sl8 A: [112099] Structural genomics target complexed with ca has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1sl8 (more details), 1.7 Å
SCOPe Domain Sequences for d1sl8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sl8a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Jellyfish (Aequorea victoria), aequorin 1 [TaxId: 6100]} npkwigrhkhmfnfldvnhngrisldemvykasdivinnlgatpeqakrhkdaveaffgg agmkygvetewpeyiegwkrlaseelkrysknqitlirlwgdalfdiidkdqngaislde wkaytksagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpaceklyggav p
Timeline for d1sl8a_: