Lineage for d1sl7a_ (1sl7 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 537713Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 537741Protein Calcium-regulated photoprotein [47512] (4 species)
    structurally most similar to sarcoplasmic calcium-binding protein
  7. 537744Species Hydrozoa (Obelia longissima), obelin [TaxId:32570] [63541] (6 PDB entries)
  8. 537750Domain d1sl7a_: 1sl7 A: [112098]
    Structural genomics target
    complexed with ca

Details for d1sl7a_

PDB Entry: 1sl7 (more details), 2.2 Å

PDB Description: Crystal structure of calcium-loaded apo-obelin from Obelia longissima

SCOP Domain Sequences for d1sl7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sl7a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin}
tdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhqvcvea
ffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdifdkdgsgti
tldewkaygkisgispsqedceatfrhcdlddsgdldvdemtrqhlgfwytld

SCOP Domain Coordinates for d1sl7a_:

Click to download the PDB-style file with coordinates for d1sl7a_.
(The format of our PDB-style files is described here.)

Timeline for d1sl7a_: