Lineage for d1sjpb2 (1sjp B:189-372)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689773Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 689924Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 689925Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 689926Protein GroEL, A domain [52031] (4 species)
  7. 690051Species Mycobacterium tuberculosis, GroEL2 [TaxId:1773] [117456] (1 PDB entry)
  8. 690053Domain d1sjpb2: 1sjp B:189-372 [112096]
    Other proteins in same PDB: d1sjpa1, d1sjpa3, d1sjpb1, d1sjpb3

Details for d1sjpb2

PDB Entry: 1sjp (more details), 3.2 Å

PDB Description: Mycobacterium tuberculosis Chaperonin60.2
PDB Compounds: (B:) 60 kDa chaperonin 2

SCOP Domain Sequences for d1sjpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjpb2 c.8.5.1 (B:189-372) GroEL, A domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]}
gmrfdkgyisgyfvtdperqeavledpyillvsskvstvkdllpllekvigagkplliia
edvegealstlvvnkirgtfksvavkapgfgdrrkamlqdmailtggqviseevgltlen
adlsllgkarkvvvtkdettivegagdtdaiagrvaqirqeiensdsdydreklqerlak
lagg

SCOP Domain Coordinates for d1sjpb2:

Click to download the PDB-style file with coordinates for d1sjpb2.
(The format of our PDB-style files is described here.)

Timeline for d1sjpb2: