Lineage for d1sjpa2 (1sjp A:189-372)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583187Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 1583357Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 1583358Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 1583359Protein GroEL, A domain [52031] (4 species)
  7. 1583512Species Mycobacterium tuberculosis, GroEL2 [TaxId:1773] [117456] (1 PDB entry)
    Uniprot P0A520 60-514
  8. 1583513Domain d1sjpa2: 1sjp A:189-372 [112093]
    Other proteins in same PDB: d1sjpa1, d1sjpa3, d1sjpb1, d1sjpb3

Details for d1sjpa2

PDB Entry: 1sjp (more details), 3.2 Å

PDB Description: Mycobacterium tuberculosis Chaperonin60.2
PDB Compounds: (A:) 60 kDa chaperonin 2

SCOPe Domain Sequences for d1sjpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjpa2 c.8.5.1 (A:189-372) GroEL, A domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]}
gmrfdkgyisgyfvtdperqeavledpyillvsskvstvkdllpllekvigagkplliia
edvegealstlvvnkirgtfksvavkapgfgdrrkamlqdmailtggqviseevgltlen
adlsllgkarkvvvtkdettivegagdtdaiagrvaqirqeiensdsdydreklqerlak
lagg

SCOPe Domain Coordinates for d1sjpa2:

Click to download the PDB-style file with coordinates for d1sjpa2.
(The format of our PDB-style files is described here.)

Timeline for d1sjpa2: