Lineage for d1sjpa1 (1sjp A:62-134,A:408-514)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777516Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 777517Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 777518Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 777519Protein GroEL, E domain [48594] (4 species)
  7. 777633Species Mycobacterium tuberculosis, GroEL2 [TaxId:1773] [117031] (1 PDB entry)
    Uniprot P0A520 60-514
  8. 777634Domain d1sjpa1: 1sjp A:62-134,A:408-514 [112092]
    Other proteins in same PDB: d1sjpa2, d1sjpa3, d1sjpb2, d1sjpb3

Details for d1sjpa1

PDB Entry: 1sjp (more details), 3.2 Å

PDB Description: Mycobacterium tuberculosis Chaperonin60.2
PDB Compounds: (A:) 60 kDa chaperonin 2

SCOP Domain Sequences for d1sjpa1:

Sequence, based on SEQRES records: (download)

>d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]}
dpyekigaelvkevakktddvagdgtttatvlaqalvreglrnvaaganplglkrgieka
vekvtetllkgakXivagggvtllqaaptldelklegdeatganivkvaleaplkqiafn
sglepgvvaekvrnlpaghglnaqtgvyedllaagvadpvkvtrsalqnaasiaglfltt
e

Sequence, based on observed residues (ATOM records): (download)

>d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]}
dpyekigaelvkevakktttatvlaqalvreglrnvaaganplglkrgiekavekvtetl
lkgakXivagggvtllqaaptldelklegdeatganivkvaleaplkqiafnsglepgvv
aekvrnlpaghglnaqtgvyedllaagvadpvkvtrsalqnaasiaglfltte

SCOP Domain Coordinates for d1sjpa1:

Click to download the PDB-style file with coordinates for d1sjpa1.
(The format of our PDB-style files is described here.)

Timeline for d1sjpa1: