Lineage for d1si4b_ (1si4 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1977385Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1977968Species Human (Homo sapiens), delta-chain [TaxId:9606] [116750] (2 PDB entries)
    Uniprot P02042
  8. 1977971Domain d1si4b_: 1si4 B: [112088]
    Other proteins in same PDB: d1si4a_, d1si4c_
    complexed with cyn, hem

Details for d1si4b_

PDB Entry: 1si4 (more details), 2.2 Å

PDB Description: Crystal structure of Human hemoglobin A2 (in R2 state) at 2.2 A resolution
PDB Compounds: (B:) Hemoglobin delta chain

SCOPe Domain Sequences for d1si4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1si4b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens), delta-chain [TaxId: 9606]}
vhltpeektavnalwgkvnvdavggealgrllvvypwtqrffesfgdlsspdavmgnpkv
kahgkkvlgafsdglahldnlkgtfsqlselhcdklhvdpenfrllgnvlvcvlarnfgk
eftpqmqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1si4b_:

Click to download the PDB-style file with coordinates for d1si4b_.
(The format of our PDB-style files is described here.)

Timeline for d1si4b_: