Lineage for d1shrb_ (1shr B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300465Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2301191Species Human (Homo sapiens), delta-chain [TaxId:9606] [116750] (2 PDB entries)
    Uniprot P02042
  8. 2301192Domain d1shrb_: 1shr B: [112084]
    Other proteins in same PDB: d1shra_, d1shrc_
    complexed with cyn, fe, hem

Details for d1shrb_

PDB Entry: 1shr (more details), 1.88 Å

PDB Description: Crystal structure of ferrocyanide bound human hemoglobin A2 at 1.88A resolution
PDB Compounds: (B:) Hemoglobin delta chain

SCOPe Domain Sequences for d1shrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shrb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens), delta-chain [TaxId: 9606]}
vhltpeektavnalwgkvnvdavggealgrllvvypwtqrffesfgdlsspdavmgnpkv
kahgkkvlgafsdglahldnlkgtfsqlselhcdklhvdpenfrllgnvlvcvlarnfgk
eftpqmqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1shrb_:

Click to download the PDB-style file with coordinates for d1shrb_.
(The format of our PDB-style files is described here.)

Timeline for d1shrb_: