SCOPe 2.02: Domain d1shrb_: 1shr B:

Lineage for d1shrb_ (1shr B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Human (Homo sapiens), delta-chain [TaxId:9606] [116750] (2 PDB entries)
   Uniprot P02042

8. Domain d1shrb_: 1shr B: [112084]
   Other proteins in same PDB: d1shra_, d1shrc_
   complexed with cyn, fe, hem

Details for d1shrb_

PDB Entry: 1shr, 1.88 Å

PDB Description: Crystal structure of ferrocyanide bound human hemoglobin A2 at 1.88A resolution

PDB Compounds: (B:) Hemoglobin delta chain

SCOPe Domain Sequences for d1shrb_:

Sequence; same for both SEQRES and ATOM records:

>d1shrb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens), delta-chain [TaxId: 9606]}
vhltpeektavnalwgkvnvdavggealgrllvvypwtqrffesfgdlsspdavmgnpkv
kahgkkvlgafsdglahldnlkgtfsqlselhcdklhvdpenfrllgnvlvcvlarnfgk
eftpqmqaayqkvvagvanalahkyh

Timeline for d1shrb_:

• d1shrb_ first appeared in SCOP 1.71
  
• d1shrb_ appears in SCOPe 2.01
  
• d1shrb_ appears in SCOPe 2.03
  
• d1shrb_ appears in the current release, SCOPe 2.08