Lineage for d1sfja_ (1sfj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834951Protein Type I 3-dehydroquinate dehydratase [51586] (4 species)
  7. 2834981Species Staphylococcus aureus [TaxId:1280] [117378] (2 PDB entries)
    Uniprot Q6GII7
  8. 2834984Domain d1sfja_: 1sfj A: [112075]
    complexed with dhk

Details for d1sfja_

PDB Entry: 1sfj (more details), 2.4 Å

PDB Description: 2.4A Crystal structure of Staphylococcus aureus type I 3-dehydroquinase, with 3-dehydroquinate bound
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d1sfja_:

Sequence, based on SEQRES records: (download)

>d1sfja_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]}
hvevvatitpqlyieetliqkinhridaidvlelridqfenvtvdqvaemitklkvmqds
fkllvtyrtklqggygqftndsylnlisdlaningidmidiewqadidiekhqriithlq
qynkeviishhnfestppldelqfiffkmqkfnpeyvklavmphnkndvlnllqamstfs
dtmdckvvgismsklglisrtaqgvfggaltygcigepqapgqidvtdlkaqvtly

Sequence, based on observed residues (ATOM records): (download)

>d1sfja_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]}
hvevvatitpqetliqkinhridaidvlelridqfenvtvdqvaemitklsfkllvtyrt
klqggygqftndsylnlisdlaningidmidiewqadidiekhqriithlqqynkeviis
hhnfestppldelqfiffkmqkfnpeyvklavmphnkndvlnllqamstfsdtmdckvvg
ismsklglisrtaqgvfggaltygcigepqapgqidvtdlkaqvtly

SCOPe Domain Coordinates for d1sfja_:

Click to download the PDB-style file with coordinates for d1sfja_.
(The format of our PDB-style files is described here.)

Timeline for d1sfja_: