Class a: All alpha proteins [46456] (258 folds) |
Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily) 3 helices; irregular array |
Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) |
Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins) Pfam PF06440 independent solution structure determinations of different members resulted in similar secondary structures but different folds |
Protein Homolog of theta (HOT) [116866] (1 species) |
Species Bacteriophage P1 [TaxId:10678] [116867] (2 PDB entries) |
Domain d1se7a_: 1se7 A: [112074] |
PDB Entry: 1se7 (more details)
SCOP Domain Sequences for d1se7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1se7a_ a.237.1.1 (A:) Homolog of theta (HOT) {Bacteriophage P1 [TaxId: 10678]} mydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhy rqlslqlpkgsdpayqkddavkk
Timeline for d1se7a_: