Lineage for d1se7a_ (1se7 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015810Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
    3 helices; irregular array
  4. 2015811Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) (S)
    automatically mapped to Pfam PF06440
  5. 2015812Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 protein domains)
    Pfam PF06440
    independent solution structure determinations of different members resulted in similar secondary structures but different folds
  6. 2015813Protein Homolog of theta (HOT) [116866] (1 species)
  7. 2015814Species Bacteriophage P1 [TaxId:10678] [116867] (2 PDB entries)
    Uniprot Q71T70
  8. 2015817Domain d1se7a_: 1se7 A: [112074]

Details for d1se7a_

PDB Entry: 1se7 (more details)

PDB Description: Solution structure of the E. coli bacteriophage P1 encoded HOT protein: a homologue of the theta subunit of E. coli DNA polymerase III
PDB Compounds: (A:) homologue of the theta subunit of DNA polymerase III

SCOPe Domain Sequences for d1se7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se7a_ a.237.1.1 (A:) Homolog of theta (HOT) {Bacteriophage P1 [TaxId: 10678]}
mydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhy
rqlslqlpkgsdpayqkddavkk

SCOPe Domain Coordinates for d1se7a_:

Click to download the PDB-style file with coordinates for d1se7a_.
(The format of our PDB-style files is described here.)

Timeline for d1se7a_: