Lineage for d1scva_ (1scv A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1269002Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1269440Protein Troponin C [47503] (6 species)
  7. 1269441Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
    Uniprot P09860
  8. 1269459Domain d1scva_: 1scv A: [112072]
    C-terminal domain
    complexed with ca

Details for d1scva_

PDB Entry: 1scv (more details)

PDB Description: nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i
PDB Compounds: (A:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d1scva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scva_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
mvrcmkddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdg
dknndgridydeflefmkgve

SCOPe Domain Coordinates for d1scva_:

Click to download the PDB-style file with coordinates for d1scva_.
(The format of our PDB-style files is described here.)

Timeline for d1scva_: