SCOPe 2.07: Domain d1sbrb_: 1sbr B:

Lineage for d1sbrb_ (1sbr B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families)

5. Family d.58.48.2: Putative thiamin/HMP-binding protein YkoF [110987] (1 protein)
   duplication: one subunit consists of two domains assembled as in the MHT1178-like dimer

6. Protein Putative thiamin/HMP-binding protein YkoF [110988] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110989] (3 PDB entries)
   Uniprot O34911

8. Domain d1sbrb_: 1sbr B: [112067]
   complexed with ca, vib

Details for d1sbrb_

PDB Entry: 1sbr, 2.3 Å

PDB Description: the structure and function of b. subtilis ykof gene product: the complex with thiamin

PDB Compounds: (B:) ykoF

SCOPe Domain Sequences for d1sbrb_:

Sequence, based on SEQRES records:

>d1sbrb_ d.58.48.2 (B:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepd
ymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnls
ansp

Sequence, based on observed residues (ATOM records):

>d1sbrb_ d.58.48.2 (B:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylsdkrvnedavrglkaeapcqfalypmnepdym
glimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsan
sp

Timeline for d1sbrb_:

• d1sbrb_ first appeared in SCOP 1.71
  
• d1sbrb_ appears in SCOPe 2.06
  
• d1sbrb_ appears in the current release, SCOPe 2.08