Lineage for d1sbra_ (1sbr A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562549Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) (S)
  5. 2562575Family d.58.48.2: Putative thiamin/HMP-binding protein YkoF [110987] (1 protein)
    duplication: one subunit consists of two domains assembled as in the MHT1178-like dimer
  6. 2562576Protein Putative thiamin/HMP-binding protein YkoF [110988] (1 species)
  7. 2562577Species Bacillus subtilis [TaxId:1423] [110989] (3 PDB entries)
    Uniprot O34911
  8. 2562584Domain d1sbra_: 1sbr A: [112066]
    complexed with ca, vib

Details for d1sbra_

PDB Entry: 1sbr (more details), 2.3 Å

PDB Description: the structure and function of b. subtilis ykof gene product: the complex with thiamin
PDB Compounds: (A:) ykoF

SCOPe Domain Sequences for d1sbra_:

Sequence, based on SEQRES records: (download)

>d1sbra_ d.58.48.2 (A:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepd
ymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnls
anspsr

Sequence, based on observed residues (ATOM records): (download)

>d1sbra_ d.58.48.2 (A:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylkrvnedavrglkaeapcqfalypmnepdymgl
imeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsansp
sr

SCOPe Domain Coordinates for d1sbra_:

Click to download the PDB-style file with coordinates for d1sbra_.
(The format of our PDB-style files is described here.)

Timeline for d1sbra_: