SCOPe 2.06: Domain d1sbra_: 1sbr A:

Lineage for d1sbra_ (1sbr A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families)

5. Family d.58.48.2: Putative thiamin/HMP-binding protein YkoF [110987] (1 protein)
   duplication: one subunit consists of two domains assembled as in the MHT1178-like dimer

6. Protein Putative thiamin/HMP-binding protein YkoF [110988] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110989] (3 PDB entries)
   Uniprot O34911

8. Domain d1sbra_: 1sbr A: [112066]
   complexed with ca, vib

Details for d1sbra_

PDB Entry: 1sbr, 2.3 Å

PDB Description: the structure and function of b. subtilis ykof gene product: the complex with thiamin

PDB Compounds: (A:) ykoF

SCOPe Domain Sequences for d1sbra_:

Sequence, based on SEQRES records:

>d1sbra_ d.58.48.2 (A:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepd
ymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnls
anspsr

Sequence, based on observed residues (ATOM records):

>d1sbra_ d.58.48.2 (A:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylkrvnedavrglkaeapcqfalypmnepdymgl
imeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsansp
sr

Timeline for d1sbra_:

• d1sbra_ first appeared in SCOP 1.71
  
• d1sbra_ appears in SCOPe 2.05
  
• d1sbra_ appears in SCOPe 2.07
  
• d1sbra_ appears in the current release, SCOPe 2.08