Lineage for d1sbra_ (1sbr A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) (S)
  5. Family d.58.48.2: Putative thiamin/HMP-binding protein YkoF [110987] (1 protein)
    duplication: one subunit consists of two domains assembled as in the MHT1178-like dimer
  6. Protein Putative thiamin/HMP-binding protein YkoF [110988] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [110989] (3 PDB entries)
    Uniprot O34911
  8. Domain d1sbra_: 1sbr A: [112066]
    complexed with ca, vib

Details for d1sbra_

PDB Entry: 1sbr (more details), 2.3 Å

PDB Description: The structure and function of B. subtilis YkoF gene product: the complex with thiamin
PDB Compounds: (A:) ykoF

SCOPe Domain Sequences for d1sbra_:

Sequence, based on SEQRES records: (download)

>d1sbra_ d.58.48.2 (A:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepd
ymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnls
anspsr

Sequence, based on observed residues (ATOM records): (download)

>d1sbra_ d.58.48.2 (A:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylkrvnedavrglkaeapcqfalypmnepdymgl
imeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsansp
sr

SCOPe Domain Coordinates for d1sbra_ are not available.

Timeline for d1sbra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sbrb_