SCOPe 2.04: Domain d1sb3f2: 1sb3 F:1-81

Lineage for d1sb3f2 (1sb3 F:1-81)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain [117836] (1 species)

7. Species Thauera aromatica [TaxId:59405] [117837] (2 PDB entries)
   Uniprot O33818

8. Domain d1sb3f2: 1sb3 F:1-81 [112063]
   Other proteins in same PDB: d1sb3a1, d1sb3a2, d1sb3b1, d1sb3b2, d1sb3c1, d1sb3d1, d1sb3d2, d1sb3e1, d1sb3e2, d1sb3f1
   complexed with epe, fad, fes, pcd, sf4, so4

Details for d1sb3f2

PDB Entry: 1sb3, 2.2 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica

PDB Compounds: (F:) 4-hydroxybenzoyl-CoA reductase gamma subunit

SCOPe Domain Sequences for d1sb3f2:

Sequence; same for both SEQRES and ATOM records:

>d1sb3f2 d.15.4.2 (F:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]}
mknilrltlngraredlvpdnmllldylretvgltgtkqgcdggecgactvlvddrprla
cstlahqvagkkvetveslat

Timeline for d1sb3f2:

• d1sb3f2 first appeared in SCOP 1.71
  
• d1sb3f2 appears in SCOPe 2.03
  
• d1sb3f2 appears in SCOPe 2.05
  
• d1sb3f2 appears in the current release, SCOPe 2.08