![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain [117836] (1 species) |
![]() | Species Thauera aromatica [TaxId:59405] [117837] (2 PDB entries) Uniprot O33818 |
![]() | Domain d1sb3f2: 1sb3 F:1-81 [112063] Other proteins in same PDB: d1sb3a1, d1sb3a2, d1sb3b1, d1sb3b2, d1sb3c1, d1sb3d1, d1sb3d2, d1sb3e1, d1sb3e2, d1sb3f1 complexed with epe, fad, fes, pcd, sf4, so4 |
PDB Entry: 1sb3 (more details), 2.2 Å
SCOPe Domain Sequences for d1sb3f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sb3f2 d.15.4.2 (F:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} mknilrltlngraredlvpdnmllldylretvgltgtkqgcdggecgactvlvddrprla cstlahqvagkkvetveslat
Timeline for d1sb3f2: