Lineage for d1sb3d1 (1sb3 D:9-133)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602004Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 602005Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 602006Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 602007Protein 4-hydroxybenzoyl-CoA reductase alpha subunit HrcA, N-terminal domain [117885] (1 species)
  7. 602008Species Thauera aromatica [TaxId:59405] [117886] (2 PDB entries)
  8. 602012Domain d1sb3d1: 1sb3 D:9-133 [112058]
    Other proteins in same PDB: d1sb3a2, d1sb3b1, d1sb3b2, d1sb3c1, d1sb3c2, d1sb3d2, d1sb3e1, d1sb3e2, d1sb3f1, d1sb3f2
    complexed with epe, fad, fes, fs4, pcd, so4

Details for d1sb3d1

PDB Entry: 1sb3 (more details), 2.2 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica

SCOP Domain Sequences for d1sb3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sb3d1 d.41.1.1 (D:9-133) 4-hydroxybenzoyl-CoA reductase alpha subunit HrcA, N-terminal domain {Thauera aromatica}
gtvgvrtplvdgvekvtgkakytadiaapdalvgrilrsphaharilaidtsaaealegv
iavctgaetpvpfgvlpiaeneyplardkvryrgdpvaavaaidevtaekalalikvdye
vlpay

SCOP Domain Coordinates for d1sb3d1:

Click to download the PDB-style file with coordinates for d1sb3d1.
(The format of our PDB-style files is described here.)

Timeline for d1sb3d1: