Lineage for d1s9ja1 (1s9j A:62-382)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219307Protein Dual specificity mitogen-activated protein kinase kinase 1, Mek1 [118137] (1 species)
    OPK group (?); MAPKK subfamily; serine/threonine kinase
  7. 2219308Species Human (Homo sapiens) [TaxId:9606] [118138] (22 PDB entries)
    Uniprot Q02750 61-381
  8. 2219320Domain d1s9ja1: 1s9j A:62-382 [112049]
    Other proteins in same PDB: d1s9ja2
    complexed with atp, bbm, mg

Details for d1s9ja1

PDB Entry: 1s9j (more details), 2.4 Å

PDB Description: X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a complex with ligand and MgATP
PDB Compounds: (A:) Dual specificity mitogen-activated protein kinase kinase 1

SCOPe Domain Sequences for d1s9ja1:

Sequence, based on SEQRES records: (download)

>d1s9ja1 d.144.1.7 (A:62-382) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]}
elkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhec
nspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltylr
ekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthys
vqsdiwsmglslvemavgrypipppdakelelmfgcqvegdaaetpprprtpgrplssyg
mdsrppmaifelldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhafi
krsdaeevdfagwlcstigln

Sequence, based on observed residues (ATOM records): (download)

>d1s9ja1 d.144.1.7 (A:62-382) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]}
elkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhec
nspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltylr
ekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmavgtrsymsperlqgthysvqs
diwsmglslvemavgrypipppdakelelmfppmaifelldyivnepppklpsgvfslef
qdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigln

SCOPe Domain Coordinates for d1s9ja1:

Click to download the PDB-style file with coordinates for d1s9ja1.
(The format of our PDB-style files is described here.)

Timeline for d1s9ja1:

Domains from same chain:
(mouse over for more information)
d1s9ja2