Lineage for d1s9ja_ (1s9j A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 612169Protein Dual specificity mitogen-activated protein kinase kinase 1, Mek1 [118137] (1 species)
    OPK group (?); MAPKK subfamily; serine/threonine kinase
  7. 612170Species Human (Homo sapiens) [TaxId:9606] [118138] (1 PDB entry)
  8. 612171Domain d1s9ja_: 1s9j A: [112049]
    complexed with atp, bbm, mg

Details for d1s9ja_

PDB Entry: 1s9j (more details), 2.4 Å

PDB Description: X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a complex with ligand and MgATP

SCOP Domain Sequences for d1s9ja_:

Sequence, based on SEQRES records: (download)

>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens)}
melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthy
svqsdiwsmglslvemavgrypipppdakelelmfgcqvegdaaetpprprtpgrplssy
gmdsrppmaifelldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhaf
ikrsdaeevdfagwlcstigln

Sequence, based on observed residues (ATOM records): (download)

>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens)}
melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmavgtrsymsperlqgthysvq
sdiwsmglslvemavgrypipppdakelelmfppmaifelldyivnepppklpsgvfsle
fqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigln

SCOP Domain Coordinates for d1s9ja_:

Click to download the PDB-style file with coordinates for d1s9ja_.
(The format of our PDB-style files is described here.)

Timeline for d1s9ja_: