Lineage for d1s9ia_ (1s9i A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543498Protein Dual specificity mitogen-activated protein kinase kinase 2, Mek2 [118135] (1 species)
    OPK group (?); MAPKK subfamily; serine/threonine kinase
  7. 2543499Species Human (Homo sapiens) [TaxId:9606] [118136] (1 PDB entry)
    Uniprot P36507 60-393
  8. 2543500Domain d1s9ia_: 1s9i A: [112047]
    complexed with 5ea, atp, mg

Details for d1s9ia_

PDB Entry: 1s9i (more details), 3.2 Å

PDB Description: X-ray structure of the human mitogen-activated protein kinase kinase 2 (MEK2)in a complex with ligand and MgATP
PDB Compounds: (A:) Dual specificity mitogen-activated protein kinase kinase 2

SCOPe Domain Sequences for d1s9ia_:

Sequence, based on SEQRES records: (download)

>d1s9ia_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 2, Mek2 {Human (Homo sapiens) [TaxId: 9606]}
qkakvgelkdddferiselgagnggvvtkvqhrpsglimarklihleikpairnqiirel
qvlhecnspyivgfygafysdgeisicmehmdggsldqvlkeakripeeilgkvsiavlr
glaylrekhqimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymaperl
qgthysvqsdiwsmglslvelavgrypipppdakeleaifgrpvvdgeegephsisprpr
ppgrpvsghgmdsrpamaifelldyivnepppklpngvftpdfqefvnkcliknpaerad
lkmltnhtfikrseveevdfagwlcktlrlnqpg

Sequence, based on observed residues (ATOM records): (download)

>d1s9ia_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 2, Mek2 {Human (Homo sapiens) [TaxId: 9606]}
qkakvgelkdddferiselgagnggvvtkvqhrpsglimarklihleikpairnqiirel
qvlhecnspyivgfygafysdgeisicmehmdggsldqvlkeakripeeilgkvsiavlr
glaylrekhqimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmvgtrsymaperlqgth
ysvqsdiwsmglslvelavgrypipppdakeleaifgrpvvdrpamaifelldyivnepp
pklpngvftpdfqefvnkcliknpaeradlkmltnhtfikrseveevdfagwlcktlrln
qpg

SCOPe Domain Coordinates for d1s9ia_:

Click to download the PDB-style file with coordinates for d1s9ia_.
(The format of our PDB-style files is described here.)

Timeline for d1s9ia_: