Lineage for d1s99a_ (1s99 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 605185Superfamily d.58.48: MTH1187/YkoF-like [89957] (2 families) (S)
  5. 605202Family d.58.48.2: Putative thiamin/HMP-binding protein YkoF [110987] (1 protein)
    duplication: one subunit consists of two domains assembled as in the MHT1178-like dimer
  6. 605203Protein Putative thiamin/HMP-binding protein YkoF [110988] (1 species)
  7. 605204Species Bacillus subtilis [TaxId:1423] [110989] (3 PDB entries)
  8. 605205Domain d1s99a_: 1s99 A: [112046]
    complexed with act, ca; mutant

Details for d1s99a_

PDB Entry: 1s99 (more details), 1.65 Å

PDB Description: the structure and function of b. subtilis ykof gene product: ligand free protein

SCOP Domain Sequences for d1s99a_:

Sequence, based on SEQRES records: (download)

>d1s99a_ d.58.48.2 (A:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis}
riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepd
ymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnls
anspsrknr

Sequence, based on observed residues (ATOM records): (download)

>d1s99a_ d.58.48.2 (A:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis}
riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtyldkrvnedavrglkaeapcqfalypmnepdymg
limeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsans
psrknr

SCOP Domain Coordinates for d1s99a_:

Click to download the PDB-style file with coordinates for d1s99a_.
(The format of our PDB-style files is described here.)

Timeline for d1s99a_: