SCOPe 2.08: Domain d1s99a_: 1s99 A:

Lineage for d1s99a_ (1s99 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families)

5. Family d.58.48.2: Putative thiamin/HMP-binding protein YkoF [110987] (1 protein)
   duplication: one subunit consists of two domains assembled as in the MHT1178-like dimer

6. Protein Putative thiamin/HMP-binding protein YkoF [110988] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110989] (3 PDB entries)
   Uniprot O34911

8. Domain d1s99a_: 1s99 A: [112046]
   complexed with act, ca

Details for d1s99a_

PDB Entry: 1s99, 1.65 Å

PDB Description: the structure and function of b. subtilis ykof gene product: ligand free protein

PDB Compounds: (A:) ykoF

SCOPe Domain Sequences for d1s99a_:

Sequence, based on SEQRES records:

>d1s99a_ d.58.48.2 (A:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepd
ymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnls
anspsrknr

Sequence, based on observed residues (ATOM records):

>d1s99a_ d.58.48.2 (A:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalaatdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtyldkrvnedavrglkaeapcqfalypmnepdymg
limeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsans
psrknr

Timeline for d1s99a_:

• d1s99a_ first appeared in SCOP 1.71
  
• d1s99a_ appears in SCOPe 2.07