Lineage for d1s7ea2 (1s7e A:6-85)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537429Family a.35.1.7: CUT domain [116891] (3 proteins)
    Pfam 02376
  6. 537433Protein Hepatocyte nuclear factor 6 [116896] (1 species)
  7. 537434Species Mouse (Mus musculus) [TaxId:10090] [116897] (1 PDB entry)
  8. 537435Domain d1s7ea2: 1s7e A:6-85 [112045]
    Other proteins in same PDB: d1s7ea1

Details for d1s7ea2

PDB Entry: 1s7e (more details)

PDB Description: solution structure of hnf-6

SCOP Domain Sequences for d1s7ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7ea2 a.35.1.7 (A:6-85) Hepatocyte nuclear factor 6 {Mouse (Mus musculus)}
eintkevaqrittelkrysipqaifaqrvlcrsqgtlsdllrnpkpwsklksgretfrrm
wkwlqepefqrmsalrlaac

SCOP Domain Coordinates for d1s7ea2:

Click to download the PDB-style file with coordinates for d1s7ea2.
(The format of our PDB-style files is described here.)

Timeline for d1s7ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s7ea1