Lineage for d1s59e_ (1s59 E:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603791Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 603792Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 603793Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)
  7. 603921Species Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId:3702] [117950] (2 PDB entries)
  8. 603932Domain d1s59e_: 1s59 E: [112038]

Details for d1s59e_

PDB Entry: 1s59 (more details), 2.6 Å

PDB Description: Structure of nucleoside diphosphate kinase 2 with bound dGTP from Arabidopsis

SCOP Domain Sequences for d1s59e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s59e_ d.58.6.1 (E:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2}
veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn
lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp
engkreiglwfkegelckwdsalatwlre

SCOP Domain Coordinates for d1s59e_:

Click to download the PDB-style file with coordinates for d1s59e_.
(The format of our PDB-style files is described here.)

Timeline for d1s59e_: