Lineage for d1s59c_ (1s59 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2557936Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2557937Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2558172Species Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId:3702] [117950] (2 PDB entries)
    Uniprot O64903 79-231
  8. 2558181Domain d1s59c_: 1s59 C: [112036]
    complexed with dgi, dgt

Details for d1s59c_

PDB Entry: 1s59 (more details), 2.6 Å

PDB Description: Structure of nucleoside diphosphate kinase 2 with bound dGTP from Arabidopsis
PDB Compounds: (C:) Nucleoside diphosphate kinase II

SCOPe Domain Sequences for d1s59c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s59c_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]}
veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn
lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp
engkreiglwfkegelckwdsalatwlre

SCOPe Domain Coordinates for d1s59c_:

Click to download the PDB-style file with coordinates for d1s59c_.
(The format of our PDB-style files is described here.)

Timeline for d1s59c_: