![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
![]() | Species Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId:3702] [117950] (2 PDB entries) Uniprot O64903 79-231 |
![]() | Domain d1s59c_: 1s59 C: [112036] complexed with dgi, dgt |
PDB Entry: 1s59 (more details), 2.6 Å
SCOPe Domain Sequences for d1s59c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s59c_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp engkreiglwfkegelckwdsalatwlre
Timeline for d1s59c_: