SCOP 1.71: Domain d1s59b_: 1s59 B:

Lineage for d1s59b_ (1s59 B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId:3702] [117950] (2 PDB entries)

8. Domain d1s59b_: 1s59 B: [112035]

Details for d1s59b_

PDB Entry: 1s59, 2.6 Å

PDB Description: Structure of nucleoside diphosphate kinase 2 with bound dGTP from Arabidopsis

SCOP Domain Sequences for d1s59b_:

Sequence; same for both SEQRES and ATOM records:

>d1s59b_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2}
veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn
lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp
engkreiglwfkegelckwdsalatwlre

Timeline for d1s59b_:

• d1s59b_ is new in SCOP 1.71
  
• d1s59b_ appears in SCOP 1.73
  
• d1s59b_ appears in the current release, SCOPe 2.08