| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
| Species Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId:3702] [117950] (2 PDB entries) Uniprot O64903 79-231 |
| Domain d1s57f_: 1s57 F: [112033] complexed with epe, so4 |
PDB Entry: 1s57 (more details), 1.8 Å
SCOPe Domain Sequences for d1s57f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s57f_ d.58.6.1 (F:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]}
smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
sdspengkreiglwfkegelckwdsalatwlre
Timeline for d1s57f_: