![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein) |
![]() | Protein Nucleoside diphosphate kinase, NDK [54921] (13 species) |
![]() | Species Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId:3702] [117950] (2 PDB entries) |
![]() | Domain d1s57c_: 1s57 C: [112030] |
PDB Entry: 1s57 (more details), 1.8 Å
SCOP Domain Sequences for d1s57c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s57c_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2} veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp engkreiglwfkegelckwdsalatwlre
Timeline for d1s57c_: