SCOP 1.71: Domain d1s57c_: 1s57 C:

Lineage for d1s57c_ (1s57 C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId:3702] [117950] (2 PDB entries)

8. Domain d1s57c_: 1s57 C: [112030]

Details for d1s57c_

PDB Entry: 1s57, 1.8 Å

PDB Description: crystal structure of nucleoside diphosphate kinase 2 from Arabidopsis

SCOP Domain Sequences for d1s57c_:

Sequence; same for both SEQRES and ATOM records:

>d1s57c_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2}
veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn
lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp
engkreiglwfkegelckwdsalatwlre

Timeline for d1s57c_:

• d1s57c_ is new in SCOP 1.71
  
• d1s57c_ appears in SCOP 1.73
  
• d1s57c_ appears in the current release, SCOPe 2.08