Lineage for d1s57c_ (1s57 C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. Species Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId:3702] [117950] (2 PDB entries)
    Uniprot O64903 79-231
  8. Domain d1s57c_: 1s57 C: [112030]
    complexed with epe, so4

Details for d1s57c_

PDB Entry: 1s57 (more details), 1.8 Å

PDB Description: crystal structure of nucleoside diphosphate kinase 2 from Arabidopsis
PDB Compounds: (C:) Nucleoside diphosphate kinase II

SCOPe Domain Sequences for d1s57c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s57c_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]}
veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn
lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp
engkreiglwfkegelckwdsalatwlre

SCOPe Domain Coordinates for d1s57c_ are not available.

Timeline for d1s57c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s57a_, d1s57b_, d1s57d_, d1s57e_, d1s57f_