Lineage for d1s4ux_ (1s4u X:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2065972Family b.69.4.1: WD40-repeat [50979] (13 protein domains)
  6. 2065986Protein Antiviral protein Ski8 (Ski8p) [110287] (1 species)
  7. 2065987Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110288] (2 PDB entries)
    Uniprot Q02793
  8. 2065989Domain d1s4ux_: 1s4u X: [112027]

Details for d1s4ux_

PDB Entry: 1s4u (more details), 2.1 Å

PDB Description: Crystal Structure analysis of the beta-propeller protein Ski8p
PDB Compounds: (X:) Antiviral protein SKI8

SCOPe Domain Sequences for d1s4ux_:

Sequence, based on SEQRES records: (download)

>d1s4ux_ b.69.4.1 (X:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvfiatanagkahdadifsvsacnsftvscsgdgylkvwdnklldnenpkdksyshfvhk
sglhhvdvlqaierdafelclvattsfsgdllfyritredetkkvifekldlldsdmkkh
sfwalkwgasndrllshrlvatdvkgttyiwkfhpfadesnsltlnwsptlelqgtvesp
mtpsqfatsvdisergliatgfnngtvqiselstlrplynfesqhsminnsnsirsvkfs
pqgsllaiahdsnsfgcitlyetefgerigslsvpthssqaslgefahsswvmslsfnds
getlcsagwdgklrfwdvktkerittlnmhcddieieedilavdehgdslaepgvfdvkf
lkkgwrsgmgadlneslccvcldrsirwfr

Sequence, based on observed residues (ATOM records): (download)

>d1s4ux_ b.69.4.1 (X:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvfiatanagkahdadifsvsacnsftvscsgdgylkvwdnklldnenpkdksyshfvhk
sglhhvdvlqaierdafelclvattsfsgdllfyritrkkvifekldlldsdmkkhsfwa
lkwgaslshrlvatdvkgttyiwkfhpfadesnsltlnwsptlelqgtvespmtpsqfat
svdisergliatgfnngtvqiselstlrplynfensirsvkfspqgsllaiahdsnsfgc
itlyetefgerigslsvfahsswvmslsfndsgetlcsagwdgklrfwdvktkerittln
mhcddieieedilavdehgdslaepgvfdvkflkkgwrsneslccvcldrsirwfr

SCOPe Domain Coordinates for d1s4ux_:

Click to download the PDB-style file with coordinates for d1s4ux_.
(The format of our PDB-style files is described here.)

Timeline for d1s4ux_: