Lineage for d1s4mb2 (1s4m B:301-458)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693367Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 693539Family c.26.1.3: Adenylyltransferase [52397] (5 proteins)
  6. 693554Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species)
  7. 693555Species Thermotoga maritima [TaxId:2336] [102261] (6 PDB entries)
    TM0379
  8. 693559Domain d1s4mb2: 1s4m B:301-458 [112026]
    Other proteins in same PDB: d1s4ma1, d1s4mb1
    complexed with lum, mg

Details for d1s4mb2

PDB Entry: 1s4m (more details), 2.1 Å

PDB Description: crystal structure of flavin binding to fad synthetase from thermotoga maritina
PDB Compounds: (B:) Riboflavin kinase/FMN adenylyltransferase

SCOP Domain Sequences for d1s4mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4mb2 c.26.1.3 (B:301-458) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
evyeiedvvvqgkrvssslirnlvqegrveeipaylgr

SCOP Domain Coordinates for d1s4mb2:

Click to download the PDB-style file with coordinates for d1s4mb2.
(The format of our PDB-style files is described here.)

Timeline for d1s4mb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s4mb1